PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g03882.1.p
Common NameBRADI_5g03882, LOC100832735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 330aa    MW: 35961.2 Da    PI: 8.2991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g03882.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-151462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd +l++   ++G+g +W + +++ g++R++k+c++rw++yl
  Bradi5g03882.1.p 14 KGPWSPEEDAKLKEFMDKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding33.87.7e-1169111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T  Ed  +    +  G++ W+ Ia+ ++ gRt++++k++w++
  Bradi5g03882.1.p  69 GEFTDHEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.066966IPR017930Myb domain
SuperFamilySSF466892.55E-2611109IPR009057Homeodomain-like
SMARTSM007174.8E-111364IPR001005SANT/Myb domain
PfamPF002491.8E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231569IPR009057Homeodomain-like
CDDcd001672.19E-81662No hitNo description
SMARTSM007171.6E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.42567117IPR017930Myb domain
PfamPF002499.5E-969111IPR001005SANT/Myb domain
CDDcd001672.43E-770113No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFMD KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTDHEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLGS  120
NTGSGPPARL PRHHPHQHRP VQLLPYSSSP SSNYNTSSFF PGAGSQLLNA EPHGHLIIPT  180
LTLQPQLQDY TMLSSSLNPM ANHNHNNNVD ASVMNHMVKE ECGAMIVFGG GEQQSCSSSD  240
GTQFGQFGGR HGKELSMSFD NNNNGYGYGG YHHNNGAAVE QEVQAQLDYG YEEIKQLLMT  300
AAGGGGGDGG GLHDQLISSS HAAGKLTMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686601e-146AK368660.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077K09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581397.10.0PREDICTED: transcription factor RAX2-like
TrEMBLI1IWF50.0I1IWF5_BRADI; Uncharacterized protein
STRINGBRADI5G03882.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-76myb domain protein 36